Proteintech, 31376-1-AP, SLC15A5 Polyclonal antibody

Size: 20ul / 150ul The SLC15A5 (31376-1-AP) by Proteintech is a Polyclonal antibody targeting SLC15A5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31376-1-AP targets SLC15A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue, rat kidney tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC15A5 (Solute carrier family 15 member 5) may be involved in peptide transport; protein transport; and transmembrane transport. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34523 Product name: Recombinant human SLC15A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 530-579 aa of NM_001170798 Sequence: QRYCNLNHFNAQNIRGSNLEETLLLHEKSLKFYGSIQEFSSSIDLWETAL Predict reactive species Full Name: solute carrier family 15, member 5 Calculated Molecular Weight: 579 aa, 65 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001170798 Gene Symbol: SLC15A5 Gene ID (NCBI): 729025 RRID: AB_3669958 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6NIM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.