Iright
BRAND / VENDOR: Proteintech

Proteintech, 31387-1-AP, HOXB8 Polyclonal antibody

CATALOG NUMBER: 31387-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HOXB8 (31387-1-AP) by Proteintech is a Polyclonal antibody targeting HOXB8 in WB, ELISA applications with reactivity to human, mouse, rat samples 31387-1-AP targets HOXB8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HCT 116 cells, HT-29 cells, LoVo cells, mouse epididymis tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information HOXB8, also known as homeobox B8, is a member of the homeobox family. HOXB8 plays a role in the regulation of embryonic development. It helps determine the identity and differentiation of cells along the anterior-posterior axis of the body. ncreased expression of HOXB8 is associated with colorectal cancer. It has been found to enhance the proliferation and metastasis of colorectal cancer cells by promoting epithelial-mesenchymal transition (EMT) via STAT3 activation (PMID: 30622439). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34946 Product name: Recombinant human HOXB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-134 aa of NM_024016 Sequence: TGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQL Predict reactive species Full Name: homeobox B8 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: NM_024016 Gene Symbol: HOXB8 Gene ID (NCBI): 3218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P17481 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924