Proteintech, 31396-1-AP, MLL4 Polyclonal antibody

Size: 20ul / 150ul The MLL4 (31396-1-AP) by Proteintech is a Polyclonal antibody targeting MLL4 in WB, IF/ICC, ELISA applications with reactivity to human samples 31396-1-AP targets MLL4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MLL4, also known as KMT2B, which is an essential subunit of the H3K4 methylation complexes, regulates cell type-specific transcriptional programs through enhancer activation. Taspase 1 mediates cleavage of the MLL protein, generating 320 kDa N-terminal (MLL-N) and 180 kDa C-terminal (MLL-C) fragments (PMID: 24213472). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35385 Product name: Recombinant human MLL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 800-982 aa of BC009337 Sequence: KVQLFKIDQQQQQKVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDLATEDTSSASETESVPSRSRRGKVEAAGPGGESEPTGSGGTLAHTPRRSLPSHHGKKMRMARCGHCRGCLRVQDCGSCV Predict reactive species Full Name: myeloid/lymphoid or mixed-lineage leukemia 4 Observed Molecular Weight: 180kDa;320kDa GenBank Accession Number: BC009337 Gene Symbol: MLL4 Gene ID (NCBI): 9757 RRID: AB_3669963 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UMN6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.