Proteintech, 31405-1-AP, PDCD11 Polyclonal antibody

Size: 20ul / 150ul The PDCD11 (31405-1-AP) by Proteintech is a Polyclonal antibody targeting PDCD11 in WB, ELISA applications with reactivity to human samples 31405-1-AP targets PDCD11 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cell Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information PDCD11, also known as ALG-4, RRP5, or NFBP, possesses a series of S1 RNA-binding domains in the N-terminus with approximately 1,400 amino acids, followed by a tetratricopeptide repeat (TPR) domain in the C-terminus. Through S1 N-terminal domains, PDCD11 interacts with pre-rRNA to coordinate rRNA processing and assembly in the nucleolus. It also binds to Exonuclease-1 and upregulates Fas to induce cell apoptosis. Recently, PDCD11 was proved to interact with NF-κB subunits to suppress the expression of inflammatory cytokines and activate the TGFβ1 pathway, thereby modulating microglia differentiation during zebrafish development.(PMID: 38062028) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35402 Product name: Recombinant human PDCD11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1290-1480 aa of BC049838 Sequence: DNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTARVLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEERKTEAEERDQKGEKKNQKRNEKKNQKGQEEVEMPSKEKQQPQKPQAQKRGGRECRESGSEQ Predict reactive species Full Name: programmed cell death 11 Observed Molecular Weight: 209 kDa GenBank Accession Number: BC049838 Gene Symbol: PDCD11 Gene ID (NCBI): 22984 RRID: AB_3669967 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q14690 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.