Proteintech, 31407-1-AP, CMIP Polyclonal antibody

Size: 20ul / 150ul The CMIP (31407-1-AP) by Proteintech is a Polyclonal antibody targeting CMIP in WB, IHC, ELISA applications with reactivity to human samples 31407-1-AP targets CMIP in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, MCF-7 cells, K-562 cells, A549 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Cmaf‐inducing protein (CMIP) is a newly identified gene that encodes an 86 kDa protein, containing an N‐terminal pleckstrin homology domain (PH), a nuclear localization signal near the PH domain, a middle region characterized by the presence of several interacting docking sites, including a 14‐3‐3 module, a PKC domain, an Erk domain, an SH3 domain similar to the p85 regulatory subunit of phosphatidylinositol 3‐kinase (PI3K), and a C‐terminal leucine‐rich repeat (LRR) domain. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35679 Product name: Recombinant human CMIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-130 aa of BC038113 Sequence: KIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKCPRL Predict reactive species Full Name: c-Maf-inducing protein Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 86 kDa GenBank Accession Number: BC038113 Gene Symbol: CMIP Gene ID (NCBI): 80790 RRID: AB_3669968 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IY22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.