Product Description
Size: 20ul / 150ul
The CMIP (31407-1-AP) by Proteintech is a Polyclonal antibody targeting CMIP in WB, IHC, ELISA applications with reactivity to human samples
31407-1-AP targets CMIP in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Raji cells, MCF-7 cells, K-562 cells, A549 cells
Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:2000-1:12000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
Cmaf‐inducing protein (CMIP) is a newly identified gene that encodes an 86 kDa protein, containing an N‐terminal pleckstrin homology domain (PH), a nuclear localization signal near the PH domain, a middle region characterized by the presence of several interacting docking sites, including a 14‐3‐3 module, a PKC domain, an Erk domain, an SH3 domain similar to the p85 regulatory subunit of phosphatidylinositol 3‐kinase (PI3K), and a C‐terminal leucine‐rich repeat (LRR) domain.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag35679 Product name: Recombinant human CMIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-130 aa of BC038113 Sequence: KIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKCPRL Predict reactive species
Full Name: c-Maf-inducing protein
Calculated Molecular Weight: 86 kDa
Observed Molecular Weight: 86 kDa
GenBank Accession Number: BC038113
Gene Symbol: CMIP
Gene ID (NCBI): 80790
RRID: AB_3669968
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q8IY22
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924