Iright
BRAND / VENDOR: Proteintech

Proteintech, 31409-1-AP, CABIN1 Polyclonal antibody

CATALOG NUMBER: 31409-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CABIN1 (31409-1-AP) by Proteintech is a Polyclonal antibody targeting CABIN1 in WB, ELISA applications with reactivity to Human samples 31409-1-AP targets CABIN1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HCT 116 cells, Jurkat cells, K-562 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35666 Product name: Recombinant human CABIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1985-2220 aa of NM_001199281.1 Sequence: ASTLDQSKDPGPPRPHRPEATPSMASLGPEGEELARVAEGTSFPPQEPRHSPQVKMAPTSSPAEPHCWPAEAALGTGAEPTCSQEGKLRPEPRRDGEAQEAASETQPLSSPPTAASSKAPSSGSAQPPEGHPGKPEPSRAKSRPLPNMPKLVIPSAATKFPPEITVTPPTPTLLSPKGSISEETKQKLKSAILSAQSAANVRKESLCQPALEVLETSSQESSLESETDEDDDYMDI Predict reactive species Full Name: calcineurin binding protein 1 Calculated Molecular Weight: 246kDa,2220aa Observed Molecular Weight: 260 kDa GenBank Accession Number: NM_001199281.1 Gene Symbol: CABIN1 Gene ID (NCBI): 23523 RRID: AB_3669969 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y6J0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924