Iright
BRAND / VENDOR: Proteintech

Proteintech, 31411-1-AP, ZNF467 Polyclonal antibody

CATALOG NUMBER: 31411-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF467 (31411-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF467 in WB, ELISA applications with reactivity to human samples 31411-1-AP targets ZNF467 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Zinc finger protein 467 (ZNF467) is a transcription factor that promotes adipocyte differentiation and suppresses osteoblast differentiation in the bone marrow. It has 595 amino acids with a molecular mass of 65 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35758 Product name: Recombinant human ZNF467 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of NM_207336.2 Sequence: MRETLEALSSLGFSVGQPEMAPQSEPREGSHNAQEQMSSSREERALGVCSGHEAPTPEEGAHTEQAEAPCRGQACSAQKAQPVGTCPGEEWMIRKVKVEDEDQEAEEEVEWPQHLSLLPSPFPAPDLGHLAAAYKLEPGAPGALSGLALSGWGPMPEKPYGCGECERRFRDQLTLRLHQRLHRGEGPCACPDCGRSFTQRAHMLLHQRSHRGERPFPCSECDKRFSKKAHLTRH Predict reactive species Full Name: zinc finger protein 467 Calculated Molecular Weight: 65kDa,595aa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: NM_207336.2 Gene Symbol: ZNF467 Gene ID (NCBI): 168544 RRID: AB_3669971 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7Z7K2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924