Proteintech, 31421-1-AP, NDRG3 Polyclonal antibody

Size: 20ul / 150ul The NDRG3 (31421-1-AP) by Proteintech is a Polyclonal antibody targeting NDRG3 in WB, IHC, ELISA applications with reactivity to human samples 31421-1-AP targets NDRG3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Raji cells, Calu-1 cells, Ramos cells, SKOV-3 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information NDRG (N-Myc downstream-regulated gene) family is generally divided into two subfamilies, one composed of NDRG1 and NDRG3 with a homology of 67%, and the other composed of NDRG2 and NDRG4 with a homology of 58%. NDRG3 is a downstream regulatory factor of MYC, with a total length of 2588 base pairs. It is mainly expressed in ovary, prostate, testis, brain, spinal cord, thymus, heart and kidney. NDRG3 is located on chromosome 20q11.21-11.23 and encodes at least two subtypes, 375 and 363 amino acids, respectively, with an apparent molecular weight of 41 and 40 kDa, respectively. (PMID: 36619553) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33626 Product name: Recombinant human NDRG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-237 aa of NM_032013 Sequence: LSGLTTNVVDIILAHHFGQEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEI* Predict reactive species Full Name: NDRG family member 3 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 41-45 kDa GenBank Accession Number: NM_032013 Gene Symbol: NDRG3 Gene ID (NCBI): 57446 RRID: AB_3669974 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UGV2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.