Product Description
Size: 20ul / 150ul
The GNA12 (31431-1-AP) by Proteintech is a Polyclonal antibody targeting GNA12 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
31431-1-AP targets GNA12 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells
Positive IHC detected in: human hepatocellular cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
G protein subunit alpha 12 (GNA12) is a member of the G12 family of G protein alpha subunits. It has 3 isoforms and is expressed in many tissues including lung, testis and placenta. GNA12/13-mediated signaling pathways are involved in a variety of physiological processes including cell growth, cell migration, angiogenesis, platelet activation and apoptosis (PMID: 37426201).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag35068 Product name: Recombinant human GNA12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-172 aa of BC087537 Sequence: DKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSE Predict reactive species
Full Name: guanine nucleotide binding protein (G protein) alpha 12
Observed Molecular Weight: 37-39 kDa
GenBank Accession Number: BC087537
Gene Symbol: GNA12
Gene ID (NCBI): 2768
RRID: AB_3669980
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q03113
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924