Proteintech, 31440-1-AP, WDR21A Polyclonal antibody

Size: 20ul / 150ul The WDR21A (31440-1-AP) by Proteintech is a Polyclonal antibody targeting WDR21A in WB, ELISA applications with reactivity to human samples 31440-1-AP targets WDR21A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35426 Product name: Recombinant human WDR21A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC018979 Sequence: MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIAR Predict reactive species Full Name: WD repeat domain 21A Observed Molecular Weight: 55 kDa GenBank Accession Number: BC018979 Gene Symbol: WDR21A Gene ID (NCBI): 26094 RRID: AB_3669984 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WV16 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.