Proteintech, 31447-1-AP, CD155/PVR Polyclonal antibody

Size: 20ul / 150ul The CD155/PVR (31447-1-AP) by Proteintech is a Polyclonal antibody targeting CD155/PVR in WB, IHC, IF/ICC, ELISA applications with reactivity to mouse samples 31447-1-AP targets CD155/PVR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, mouse liver tissue, mouse small intestine tissue Positive IHC detected in: mouse liver tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CD155, also known as the poliovirus receptor (PVR) or Necl-5, is one of the nectin-like family members, belonging to the Ca2+ independent immunoglobulin superfamily (IgSF) in cell adhesion molecules (PMID: 37660884). CD155 is a type I transmembrane protein composed of three extracellular immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic tail. It is involved in cell-to-cell and cell-to-ECM adhesion (PMID: 32019260; 11437656). CD155 acts as a ligand for immune receptors, including TIGIT, CD96 and CD226, which are expressed on T cells and NK cells. CD155 interacts with these receptors to modulate immune responses, such as T cell activation and NK cell-mediated cytotoxicity (PMID: 37660884). CD155 serves as the entry receptor for poliovirus and thereby mediates susceptibility to poliovirus infection (PMID: 15034010). Specification Tested Reactivity: mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0903 Product name: Recombinant Mouse CD155/PVR protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-348 aa of NM_027514.2 Sequence: DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHL Predict reactive species Full Name: poliovirus receptor Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 75-85 kDa GenBank Accession Number: NM_027514.2 Gene Symbol: CD155/PVR Gene ID (NCBI): 52118 RRID: AB_3669988 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8K094 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.