Proteintech, 31453-1-AP, Tissue Factor/CD142 Polyclonal antibody

Size: 20ul / 150ul The Tissue Factor/CD142 (31453-1-AP) by Proteintech is a Polyclonal antibody targeting Tissue Factor/CD142 in WB, ELISA applications with reactivity to human samples 31453-1-AP targets Tissue Factor/CD142 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1052 Product name: Recombinant Human Coagulation Factor III/Tissue Factor protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 33-251 aa of NM_001993.5 Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE Predict reactive species Full Name: coagulation factor III (thromboplastin, tissue factor) Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 45-53 kDa GenBank Accession Number: NM_001993.5 Gene Symbol: F3 Gene ID (NCBI): 2152 RRID: AB_3669992 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P13726-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.