Proteintech, 31454-1-AP, APOE Polyclonal antibody

Size: 20ul / 150ul The APOE (31454-1-AP) by Proteintech is a Polyclonal antibody targeting APOE in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 31454-1-AP targets APOE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: U-251 cells, BV-2 cells, C2C12 cells, mouse brain tissue, mouse skeletal muscle tissue, mouse cerebellum tissue, rat brain tissue, pig cerebellum tissue Positive IHC detected in: rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Apolipoprotein E (Apoe) is a core component of plasma lipoproteins that participates in diverse biological processes, including plasma lipoprotein metabolism, intracellular cholesterol utilization, cell growth, immunoregulation, and neuronal growth and repair (PMID: 17854398). Mouse apoE, like apoE4, contains the equivalent of Arg-112 and Glu-255, but lacks the critical Arg-61 equivalent (it contains Thr-61). Thus, mouse apoE does not display apoE4 domain interaction (PMID: 11553788). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1093 Product name: Recombinant Mouse APOE protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 19-311 aa of NM_001305819.1 Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ Predict reactive species Full Name: Apolipoprotein E Calculated Molecular Weight: 36kDa Observed Molecular Weight: 31~36 kDa GenBank Accession Number: NM_001305819.1 Gene Symbol: Apoe Gene ID (NCBI): 11816 RRID: AB_3669993 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P08226 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.