Proteintech, 31464-1-AP, E2F6 Polyclonal antibody

Size: 20ul / 150ul The E2F6 (31464-1-AP) by Proteintech is a Polyclonal antibody targeting E2F6 in WB, IF/ICC, ELISA applications with reactivity to human samples 31464-1-AP targets E2F6 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information E2F6 is a member of the E2F family of TFs that control cell proliferation and cell fate. Cancer patients with high E2F6 expression in tumors, such as glioblastoma, breast cancer, and hepatocellular carcinoma, have poor prognosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35112 Product name: Recombinant human E2F6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 232-281 aa of BC008348 Sequence: DVYLCEVEQGQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN Predict reactive species Full Name: E2F transcription factor 6 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC008348 Gene Symbol: E2F6 Gene ID (NCBI): 1876 RRID: AB_3669998 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75461 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.