Proteintech, 31467-1-AP, IL-27 Polyclonal antibody

Size: 20ul / 150ul The IL-27 (31467-1-AP) by Proteintech is a Polyclonal antibody targeting IL-27 in WB, ELISA applications with reactivity to mouse samples 31467-1-AP targets IL-27 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: LPS and Brefeldin A treated RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information IL-27, as a member of the IL-6/IL-12 family, is a heterodimeric cytokine composed of two subunits: p28 (IL-27a) and EBI3 (IL-27b). IL-27 acts on various cell types, including T cells, B cells, macrophages, dendritic cells, natural killer (NK) cells and non-hematopoietic cells. IL-27 plays a critical role in the early regulation of T helper type 1 initiation, and enhances proliferation of naive CD4+T cells and naive B cells. It, however, also exerts anti-inflammatory functions by inhibiting the development of Th17 cells and inducing IL-10 producing type 1 regulatory T cells. IL-27 is a potentially promising cytokine for therapeutic approaches on various human diseases. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0404 Product name: recombinant mouse IL-27(IL-27B+IL-27A) protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 1-432 aa of Sequence: YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGGGSGGGSGGGSGGGSFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS Predict reactive species Full Name: interleukin 27 Observed Molecular Weight: 28 kDa Gene Symbol: Il27 Gene ID (NCBI): 246779 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.