Proteintech, 31483-1-AP, AGPAT2 Polyclonal antibody

Size: 20ul / 150ul The AGPAT2 (31483-1-AP) by Proteintech is a Polyclonal antibody targeting AGPAT2 in WB, ELISA applications with reactivity to Human samples 31483-1-AP targets AGPAT2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: L02 cells, THP-1 cells, human adipose tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2) belongs to a family of enzymes catalyzing the sn-2 acylation of the glycerol-3-phosphate backbone. AGPAT2 is highly expressed in adipose tissues, liver, and skeletal muscle. AGPAT2 is the only AGPAT isoform whose loss-of-function mutations cause a severe form of human congenital generalized lipodystrophy (PMID: 34824276). Human and mouse AGPAT2 have a calculated molecular mass of 31 kDa, and an alternatively spliced form of AGPAT2 mRNA, encoding a protein of 246 rather than 278 amino acids, is also found in human (PMID: 19336658). Western detected AGPAT2 at an apparent molecular mass of 27 kDa. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34761 Product name: Recombinant human AGPAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-279 aa of BC019292 Sequence: VPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ Predict reactive species Full Name: 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC019292 Gene Symbol: AGPAT2 Gene ID (NCBI): 10555 RRID: AB_3670000 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O15120 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.