Proteintech, 31486-1-AP, SLC38A7 Polyclonal antibody

Size: 20ul / 150ul The SLC38A7 (31486-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A7 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 31486-1-AP targets SLC38A7 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SLC38A7 also known as SNAT7, is a system N transporter with a substrate preference for L-glutamine(PMID: 21511949). SLC38A7 symporter that selectively transports sodium ions and amino acids, such as L-glutamine and L-asparagine from the lysosome into the cytoplasm and may participate in mTORC1 activation (PubMed:28416685, PubMed:35561222). colocalization of Slc38a7 with neuronal markers in excitatory and inhibitory neurons, but not in astrocytes or glial cells. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35081 Product name: Recombinant human SLC38A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC001961 Sequence: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST Predict reactive species Full Name: solute carrier family 38, member 7 Calculated Molecular Weight: 50 kDa GenBank Accession Number: BC001961 Gene Symbol: SLC38A7 Gene ID (NCBI): 55238 RRID: AB_3670003 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NVC3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.