Proteintech, 31494-1-AP, PROSER1 Polyclonal antibody

Size: 20ul / 150ul The PROSER1 (31494-1-AP) by Proteintech is a Polyclonal antibody targeting PROSER1 in IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 31494-1-AP targets PROSER1 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: Jurkat cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PROSER1 (proline- and serine-rich 1) is a chromatin-binding protein encoded by the 13q13.3 locus. It interacts with all three TET enzymes and serves as the core scaffold of the TOPD (TET‑OGT‑PROSER1‑DBHS) complex, stabilizing the binding between TET2 and OGT while promoting O‑GlcNAcylation, thereby enhancing DNA demethylation activity. PROSER1 has recently been found to be associated with neurodevelopmental disorders. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35678 Product name: Recombinant human C13orf23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of NM_025138.4 Sequence: MDKKSFEMVLDEIRKAVLTEYKLKAIEYVHGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAMISSCGTIPGNPYPKGRPSRINGIFPGTPLKKDGEECTNEGKGI Predict reactive species Full Name: chromosome 13 open reading frame 23 Calculated Molecular Weight: 96kDa，944aa Observed Molecular Weight: 100 kDa GenBank Accession Number: NM_025138.4 Gene Symbol: C13orf23 Gene ID (NCBI): 80209 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86XN7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.