Proteintech, 31499-1-AP, Angiopoietin-2 Polyclonal antibody

Size: 20ul / 150ul The Angiopoietin-2 (31499-1-AP) by Proteintech is a Polyclonal antibody targeting Angiopoietin-2 in WB, IHC, IP, ELISA applications with reactivity to mouse, rat samples 31499-1-AP targets Angiopoietin-2 in WB, IHC, IP, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse kidney tissue, rat lung tissue Positive IP detected in: rat lung tissue Positive IHC detected in: mouse brain tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Angiopoietin-2 (ANGPT2, ANG-2) is as a regulator of vessel enlargement, and ANGPT2 inhibition prevented pathological vessel enlargement (PMID: 34758631). ANGPT2 destabilizes vessels and promotes angiogenesis through antagonism of ANGPT1 (PMID: 34758631). Ang2 was initially identified by homology with Ang1 and is expressed predominantly by endothelial cells, where it is stored in intracellular secretory granules called Weibel-Palade bodies (WPB) and promptly released after endothelium activation. Like Ang1, Ang2 binds to Tie2 receptor, but with different pathophysiological effects. While Ang1 fosters endothelial stabilization, Ang2 can antagonize Ang1, blocking Tie2 activation and leading to vessel destabilization (PMID: 31756341). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0666 Product name: recombinant mouse Angiopoietin-2 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 68-496 aa of NM_007426.4 Sequence: DAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF Predict reactive species Full Name: angiopoietin 2 Calculated Molecular Weight: 56KD Observed Molecular Weight: 68 kDa GenBank Accession Number: NM_007426.4 Gene Symbol: Angpt2 Gene ID (NCBI): 11601 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O35608 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.