Proteintech, 31522-1-AP, ARSE Polyclonal antibody

Size: 20ul / 150ul The ARSE (31522-1-AP) by Proteintech is a Polyclonal antibody targeting ARSE in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 31522-1-AP targets ARSE in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ARSE (arylsulfatase E), is a member of the sulfatase family. This enzyme is glycosylated post-translationally. Sulfatases, including ARSE, are essential for the correct composition of the bone and cartilage matrix. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24371 Product name: Recombinant human ARSE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 524-567 aa of BC130438 Sequence: HILTPASEPVFYQVMERVQQAVWEHQRTLSPVPLQLDRLGNIWR Predict reactive species Full Name: arylsulfatase E (chondrodysplasia punctata 1) GenBank Accession Number: BC130438 Gene Symbol: ARSE Gene ID (NCBI): 415 RRID: AB_3670019 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P51690 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.