Iright
BRAND / VENDOR: Proteintech

Proteintech, 31525-1-AP, TMEM258 Polyclonal antibody

CATALOG NUMBER: 31525-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM258 (31525-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM258 in WB, IHC, ELISA applications with reactivity to human samples 31525-1-AP targets TMEM258 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, PC-3 cells, SH-SY5Y cells, U2OS cells Positive IHC detected in: mouse kidney tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TMEM258, or transmembrane protein 258, is a component of the oligosaccharyltransferase (OST) complex. Research has shown that TMEM258 is involved in controlling ER stress and intestinal inflammation. In particular, it has been identified as a central regulator of intestinal homeostasis. The loss of TMEM258 leads to unresolved ER stress, which can result in apoptosis (PMID: 27974209). The calculated MW is 9 kDa, The observed MW is multiple bands, which may be caused by Glycosylation modification. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35142 Product name: Recombinant human TMEM258 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC015968 Sequence: MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKEL Predict reactive species Full Name: chromosome 11 open reading frame 10 Observed Molecular Weight: 10 and 16 kDa GenBank Accession Number: BC015968 Gene Symbol: C11orf10 Gene ID (NCBI): 746 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P61165 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924