Iright
BRAND / VENDOR: Proteintech

Proteintech, 31537-1-AP, ATPBD3 Polyclonal antibody

CATALOG NUMBER: 31537-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATPBD3 (31537-1-AP) by Proteintech is a Polyclonal antibody targeting ATPBD3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 31537-1-AP targets ATPBD3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ATPBD3, also known as CTU1, NCS6, is a subunit of a highly conserved protein complex involved in the thiolation of wobble U34(PMID: 18391219). ATPBD3 directly binds tRNAs and probably acts by catalyzing the adenylation of tRNAs, an intermediate required for 2-thiolation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35037 Product name: Recombinant human ATPBD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-200 aa of NM_145232 Sequence: PGAVVAVGASGGKDSTVLAHVLRALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARRVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGGLGS Predict reactive species Full Name: ATP binding domain 3 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 30-36 kDa GenBank Accession Number: NM_145232 Gene Symbol: ATPBD3 Gene ID (NCBI): 90353 RRID: AB_3670027 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7Z7A3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924