Iright
BRAND / VENDOR: Proteintech

Proteintech, 31546-1-AP, UTY Polyclonal antibody

CATALOG NUMBER: 31546-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UTY (31546-1-AP) by Proteintech is a Polyclonal antibody targeting UTY in WB, ELISA applications with reactivity to human samples 31546-1-AP targets UTY in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information UTY (Ubiquitously Transcribed Tetratricopeptide Repeat Containing, Y-Linked) is a protein-coding gene located on the Y chromosome. It is the Y-linked homolog of the X-linked gene KDM6A, which encodes a histone demethylase. UTY is involved in the regulation of gene expression and chromatin structure, similar to its X-linked counterpart KDM6A (PMID: 31097364). UTY is expressed in various tissues and is predicted to be involved in transcription, translation, and nucleic acid binding, which are central to the regulation of gene expression during development, immune function, cell proliferation, and differentiation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35806 Product name: Recombinant human UTY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 560-655 aa of NM_007125.4 Sequence: QQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCLSGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATS Predict reactive species Full Name: ubiquitously transcribed tetratricopeptide repeat gene, Y-linked Calculated Molecular Weight: 150kDa,1347aa Observed Molecular Weight: 130-160kDa GenBank Accession Number: NM_007125.4 Gene Symbol: UTY Gene ID (NCBI): 7404 RRID: AB_3670033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O14607 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924