Proteintech, 31559-1-AP, NUDT4 Polyclonal antibody

Size: 20ul / 150ul The NUDT4 (31559-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT4 in WB, ELISA applications with reactivity to human, mouse, rat samples 31559-1-AP targets NUDT4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NUDT4 also known as DIPP2, NUDT4B, belongs to the Nudix hydrolase family. NUDT4 is an inositol diphosphate polyphosphate phosphatase (DIPP2) whose main function is to catalyze hydrolysis reactions of nucleotide derivatives and to regulate the metabolism of inositol diphosphate polyphosphates. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34852 Product name: Recombinant human NUDT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-181 aa of BC012069 Sequence: LQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 4 Calculated Molecular Weight: 181 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC012069 Gene Symbol: NUDT4 Gene ID (NCBI): 11163 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A0A024RBG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.