Iright
BRAND / VENDOR: Proteintech

Proteintech, 31574-1-AP, UNK Polyclonal antibody

CATALOG NUMBER: 31574-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UNK (31574-1-AP) by Proteintech is a Polyclonal antibody targeting UNK in WB, IF/ICC, ELISA applications with reactivity to human samples 31574-1-AP targets UNK in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells Positive IF/ICC detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Unkempt (UNK) is a sequence-specific RNA-binding protein which plays an important role in the establishment and maintenance of the early morphology of cortical neurons during embryonic development. UNK gene encodes a zinc finger/RING domain containing protein, as a negative regulator of the timing of photoreceptor differentiation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36222 Product name: Recombinant human UNK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 640-810 aa of BC053362 Sequence: SGPGAAELARLRQELDEANSTIKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERLHAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVLPCQHAALCELCAEGSECPICQPGRAHTLQS Predict reactive species Full Name: unkempt homolog (Drosophila) Observed Molecular Weight: 88~100 kDa GenBank Accession Number: BC053362 Gene Symbol: UNK Gene ID (NCBI): 85451 RRID: AB_3670041 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9C0B0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924