Iright
BRAND / VENDOR: Proteintech

Proteintech, 31586-1-AP, RASA2 Polyclonal antibody

CATALOG NUMBER: 31586-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RASA2 (31586-1-AP) by Proteintech is a Polyclonal antibody targeting RASA2 in IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 31586-1-AP targets RASA2 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: Jurkat cells, A431 cells Positive IHC detected in: human Hepatocellular carcinomaNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Ras GTPase-activating protein 2 (RASA2) is also named GAP1M and RASGAP. RASA2 was a critical RAS-specific GAP, inhibition of which permitted increased proliferation following TCR stimulation under conditions of immunosuppression (PMID: 37858490). RASA2 was identified as an inhibitor of RAS signaling in multiple human tumors, including melanoma, where inactivating RASA2 mutations have been found (PMID: 26502337). RASA2 is also one of the genes mutated in Noonan syndrome, a Rasopathy associated with developmental defects and elevated RAS activity (PMID: 25049390). RASA2 is expressed in both CD4+ and CD8+ T cells (PMID: 36002574). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35885 Product name: Recombinant human RASA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 700-850 aa of NM_001303245 Sequence: VLCRVSRCNQNRLSFYHPSVYLNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKMEEACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS Predict reactive species Full Name: RAS p21 protein activator 2 Calculated Molecular Weight: 96kDa Observed Molecular Weight: 97 kDa GenBank Accession Number: NM_001303245 Gene Symbol: RASA2 Gene ID (NCBI): 5922 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q15283 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924