Product Description
Size: 20ul / 150ul
The OATP1A2 (31626-1-AP) by Proteintech is a Polyclonal antibody targeting OATP1A2 in WB, ELISA applications with reactivity to human, mouse, rat samples
31626-1-AP targets OATP1A2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HEK-293 cells, human heart tissue, mouse heart tissue, rat liver tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Background Information
SLCO1A2 also known as OATP1A2, is a member of the SLC21A family of solute carriers. SLCO1A2 encodes a sodium-independent transporter that mediates cellular uptake of organic ions in the liver(PMID: 19129463). It has been reported that SLCO1A2 detected a nonglycosylated form around 59kDa and 70-75 kDa glycosylated form(PMID: 15632119).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag34497 Product name: Recombinant human SLCO1A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 406-513 aa of NM_021094 Sequence: FLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYF Predict reactive species
Full Name: solute carrier organic anion transporter family, member 1A2
Calculated Molecular Weight: 670 aa, 74 kDa
Observed Molecular Weight: 70 kDa
GenBank Accession Number: NM_021094
Gene Symbol: SLCO1A2
Gene ID (NCBI): 6579
RRID: AB_3670054
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: P46721
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924