Proteintech, 31631-1-AP, DCHS2 Polyclonal antibody

Size: 20ul / 150ul The DCHS2 (31631-1-AP) by Proteintech is a Polyclonal antibody targeting DCHS2 in WB, ELISA applications with reactivity to human samples 31631-1-AP targets DCHS2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-251 cells, U-118 MG cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DCHS2 is a calcium-dependent cell adhesion molecule belonging to the cadherin superfamily. It plays an important role in cell-cell adhesion, tissue morphogenesis, and signal transduction, especially in forming cell polarity and tissue structure during development. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35080 Product name: Recombinant human DCHS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2500-2600 aa of NM_001358235 Sequence: IFTISPVLLLDTISTTQFLVEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQNNFHV Predict reactive species Full Name: dachsous 2 (Drosophila) Calculated Molecular Weight: 370 kDa Observed Molecular Weight: ~75 kDa GenBank Accession Number: NM_001358235 Gene Symbol: DCHS2 Gene ID (NCBI): 54798 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6V1P9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.