Product Description
Size: 20ul / 150ul
The FGR (31641-1-AP) by Proteintech is a Polyclonal antibody targeting FGR in WB, IF/ICC, ELISA applications with reactivity to human samples
31641-1-AP targets FGR in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HL-60 cells, Raji cells
Positive IF/ICC detected in: Raji cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
FGR (Tyrosine-protein kinase Fgr), a member of the Src family of tyrosine kinases, is highly expressed in many cancers and can regulate mitochondrial oxidative phosphorylation (PMID: 37475042).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag34944 Product name: Recombinant human FGR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of NM_005248 Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA Predict reactive species
Full Name: Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
Calculated Molecular Weight: 59 kDa
Observed Molecular Weight: 59 kDa
GenBank Accession Number: NM_005248
Gene Symbol: FGR
Gene ID (NCBI): 2268
RRID: AB_3670061
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: P09769
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924