Proteintech, 31652-1-AP, Timp-3 Polyclonal antibody

Size: 20ul / 150ul The Timp-3 (31652-1-AP) by Proteintech is a Polyclonal antibody targeting Timp-3 in WB, ELISA applications with reactivity to human samples 31652-1-AP targets Timp-3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Timp-3 (TIMP metallopeptidase inhibitor 3), also known as SFD. It is expected to be located in extracellular space, and the protein is enriched in the placenta tissue and fat tissue. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation, and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. TIMP-3 is expressed as an unglycosylated 24 kDa and glycosylated 29 kDa protein with inhibitory activity against interstitial collagenase, stromelysin-1, and gelatinases A and B (PMID:11827795). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34657 Product name: Recombinant human Timp-3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-211 aa of BC014277 Sequence: MLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP Predict reactive species Full Name: TIMP metallopeptidase inhibitor 3 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 20-30 kDa GenBank Accession Number: BC014277 Gene Symbol: TIMP3 Gene ID (NCBI): 7078 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.