Iright
BRAND / VENDOR: Proteintech

Proteintech, 31655-1-AP, CACNB3 Polyclonal antibody

CATALOG NUMBER: 31655-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CACNB3 (31655-1-AP) by Proteintech is a Polyclonal antibody targeting CACNB3 in WB, ELISA applications with reactivity to human, mouse, rat samples 31655-1-AP targets CACNB3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CACNB3, also known as CACNLB3, is a voltage-gated Ca2+ channel subunit. It has 5 isoforms and may play a role in the regulation of transcription factors and calcium transport. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35651 Product name: Recombinant human CACNB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-484 aa of NM_000725.3 Sequence: EYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY Predict reactive species Full Name: calcium channel, voltage-dependent, beta 3 subunit Calculated Molecular Weight: 55kDa,484aa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_000725.3 Gene Symbol: CACNB3 Gene ID (NCBI): 784 RRID: AB_3670064 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P54284 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924