Proteintech, 31658-1-AP, dysferlin Polyclonal antibody

Size: 20ul / 150ul The dysferlin (31658-1-AP) by Proteintech is a Polyclonal antibody targeting dysferlin in WB, ELISA applications with reactivity to human, mouse, rat samples 31658-1-AP targets dysferlin in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Dysferlin, also known as FER1L1, belongs to the ferlin family and is a member of a putative muscle-specific repair complex. It has many isoforms and is a large membrane protein that is most abundant in striated muscle. It plays a role in sarcolemmal repair and is a key calcium ion sensor involved in Ca(2+)-triggered synaptic vesicle-plasma membrane fusion. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35810 Product name: Recombinant human dysferlin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-210 aa of NM_001130455 Sequence: DQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSR Predict reactive species Full Name: dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) Calculated Molecular Weight: 237 kDa Observed Molecular Weight: 240 kDa GenBank Accession Number: NM_001130455 Gene Symbol: DYSF Gene ID (NCBI): 8291 RRID: AB_3670065 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75923 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.