Iright
BRAND / VENDOR: Proteintech

Proteintech, 31664-1-AP, INTS6 Polyclonal antibody

CATALOG NUMBER: 31664-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The INTS6 (31664-1-AP) by Proteintech is a Polyclonal antibody targeting INTS6 in WB, IHC, ELISA applications with reactivity to human samples 31664-1-AP targets INTS6 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, MCF-7 cells, HuH-7 cells, L02 cells, PC-3 cells, LNCaP cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information INTS6 is a component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36146 Product name: Recombinant human INTS6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 672-815 aa of BC039829 Sequence: VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ Predict reactive species Full Name: integrator complex subunit 6 Calculated Molecular Weight: 100 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC039829 Gene Symbol: INTS6 Gene ID (NCBI): 26512 RRID: AB_3670067 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UL03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924