Iright
BRAND / VENDOR: Proteintech

Proteintech, 31669-1-AP, EPB41L4B Polyclonal antibody

CATALOG NUMBER: 31669-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPB41L4B (31669-1-AP) by Proteintech is a Polyclonal antibody targeting EPB41L4B in WB, ELISA applications with reactivity to Human samples 31669-1-AP targets EPB41L4B in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Caco-2 cells, HEK-293T cells, MCF-7 cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information The 4.1 proteins, encoded by the EPB41 (erythrocyte protein band 4.1) genes, are components of the cortical cytoskeleton underlying the cell membrane. The family of 4.1 proteins consists of the eponymous 4.1R protein first identified in erythrocytes (gene: EPB41), 4.1N (EPB41L1), 4.1G (EPB41L2), 4.1B (EPB41L3) as well as the less closely related members NBL4 (EPB41L4A), EHM2 (EPB41L4B) and EPB41L5 (EPB41L5). EHM2 is conspicuous in tumor cells with high migratory potential, such as metastatic melanoma and fibrosarcoma cells. In prostate cancer, EHM2 has been reported to be overexpressed and to diminish adhesion of prostate cancer cells to collagen. (PMID: 20860828) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36353 Product name: Recombinant human EPB41L4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 550-700 aa of NM_00138562 Sequence: TPALFSEAAAHLKKLELETVKAAGPWPPLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTS Predict reactive species Full Name: erythrocyte membrane protein band 4.1 like 4B Calculated Molecular Weight: 99kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: NM_00138562 Gene Symbol: EPB41L4B Gene ID (NCBI): 54566 RRID: AB_3670069 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H329 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924