Iright
BRAND / VENDOR: Proteintech

Proteintech, 31674-1-AP, LYRM2 Polyclonal antibody

CATALOG NUMBER: 31674-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LYRM2 (31674-1-AP) by Proteintech is a Polyclonal antibody targeting LYRM2 in IP, ELISA applications with reactivity to human samples 31674-1-AP targets LYRM2 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HT-29 cells, COLO 320 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information LYR motif containing 2 (LYRM2) is an evolutionarily conserved gene which belongs to LYR (leucine-tyrosine-arginine) motif proteins (LYRMs) family. LYRM2 is the one of the top ten most significantly upregulated differentially expressed genes in trabecular osteocytes between osteoporosis and normal controls (PMID: 34252604), which is up-regulated in colorectal cancer and promotes tumor growth both in vivo and in vitro. LYRM2 locates in the mitochondrial inner membrane and matrix (PMID: 31004700). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36366 Product name: Recombinant human LYRM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-88 aa of BC009782 Sequence: QQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMITQGNMQLKELEKTLALAKS Predict reactive species Full Name: LYR motif containing 2 Observed Molecular Weight: 10 kDa GenBank Accession Number: BC009782 Gene Symbol: LYRM2 Gene ID (NCBI): 57226 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NU23 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924