Iright
BRAND / VENDOR: Proteintech

Proteintech, 31681-1-AP, INSM1 Polyclonal antibody

CATALOG NUMBER: 31681-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The INSM1 (31681-1-AP) by Proteintech is a Polyclonal antibody targeting INSM1 in WB, ELISA applications with reactivity to human, mouse, rat samples 31681-1-AP targets INSM1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Insulinoma-associated-1 (INSM1) is a zinc-finger transcription factor that was originally identified in a human insulinoma subtraction library. INSM1 plays a cardinal role as a transcription factor in the differentiation of embryonic neuroendocrine cells. In situ hybridization studies of human tissues have shown the presence of the INSM1 transcript across various brain regions, as well as in endocrine organs such as the pancreas, adrenal gland, thymus, thyroid, and the endocrine cells of the gastrointestinal tract .(PMID: 34943408, PMID: 36290282) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33774 Product name: Recombinant human INSM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-230 aa of NM_002196 Sequence: MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAERAHAALAAALACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSFNLGSPVSAESFPTPAALLGGGGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEPPAKAVKAPGAKKPKAIRKLH* Predict reactive species Full Name: insulinoma-associated 1 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 53-60 kDa GenBank Accession Number: NM_002196 Gene Symbol: INSM1 Gene ID (NCBI): 3642 RRID: AB_3670075 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q01101 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924