Iright
BRAND / VENDOR: Proteintech

Proteintech, 31692-1-AP, ATP2B3/PMCA3 Polyclonal antibody

CATALOG NUMBER: 31692-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATP2B3/PMCA3 (31692-1-AP) by Proteintech is a Polyclonal antibody targeting ATP2B3/PMCA3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31692-1-AP targets ATP2B3/PMCA3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: 37°C incubated mouse brain tissue, 37°C incubated rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information ATP2B3 also known as PMCA3, belongs to the family of P-type primary ion transport ATPases. ATP2B3 uses ATP as an energy source to transport cytosolic Ca2+ ions across the plasma membrane to the extracellular compartment. ATP2B3 is highly expressed in the brain and cerebellum and is important in regulating neuronal Ca2+. Mutations in ATP2B3 are associated with X-linked spinocerebellar ataxia-1 (PMID: 25953895, 22912398). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35923 Product name: Recombinant human ATP2B3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC047580 Sequence: MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKT Predict reactive species Full Name: ATPase, Ca++ transporting, plasma membrane 3 Observed Molecular Weight: 134 kDa GenBank Accession Number: BC047580 Gene Symbol: ATP2B3 Gene ID (NCBI): 492 RRID: AB_3670080 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q16720 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924