Iright
BRAND / VENDOR: Proteintech

Proteintech, 31699-1-AP, IRX1 Polyclonal antibody

CATALOG NUMBER: 31699-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IRX1 (31699-1-AP) by Proteintech is a Polyclonal antibody targeting IRX1 in WB, ELISA applications with reactivity to human, mouse samples 31699-1-AP targets IRX1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Iroquois homeobox protein 1 (IRX1) is a member of the Iroquois homeobox family of transcription factors which plays a crucial role in embryonic development. IRX1 has been previously shown to function as a potential tumor suppressor in rheumatoid arthritis (RA), congenital heart disease (CHD), and tumors, such as gastric cancer (GC) and osteosarcoma (PMID: 25822025, PMID:  31640472). The molecular weight of IRX1 is 50 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36597 Product name: Recombinant human IRX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 190-300 aa of BC166635 Sequence: KVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDSPLGLAKEAPEPGSTRLLSPG Predict reactive species Full Name: iroquois homeobox 1 Observed Molecular Weight: 50 kDa GenBank Accession Number: BC166635 Gene Symbol: IRX1 Gene ID (NCBI): 79192 RRID: AB_3670085 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P78414 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924