Proteintech, 31721-1-AP, Lipocalin-2/NGAL Polyclonal antibody

Size: 20ul / 150ul The Lipocalin-2/NGAL (31721-1-AP) by Proteintech is a Polyclonal antibody targeting Lipocalin-2/NGAL in WB, ELISA applications with reactivity to human, mouse samples 31721-1-AP targets Lipocalin-2/NGAL in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-29 cells, mouse bone marrow tissue, SW480 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Lipocalin-2 (LCN-2) is a adipocytokine also referred to as neutrophil gelatinase-associated lipocalin (NGAL). Lipocalin-2 is a circulatory protein responsible for the transportation of small and hydrophobic molecules to target organs. Lipocalin-2 is used as a biomarker for acute and chronic renal injury. It is present in a large variety of cells including neutrophil, hepatocytes, lung, bone marrow, adipose tissue, macrophages, thymus, non-neoplastic breast duct, prostate, and renal cells. Different functions have been associated with Lipocalin-2, including antibacterial, anti-inflammatory, and protection against cell and tissue stress (PMID:34463264). Specification Tested Reactivity: human, mouse Cited Reactivity: chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0998 Product name: Recombinant Human Lipocalin-2/NGAL protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 21-198 aa of NM_005564.5 Sequence: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG Predict reactive species Full Name: lipocalin 2 Calculated Molecular Weight: 23kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: NM_005564.5 Gene Symbol: NGAL/LCN2 Gene ID (NCBI): 3934 RRID: AB_3670098 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P80188-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.