Iright
BRAND / VENDOR: Proteintech

Proteintech, 31748-1-AP, C12orf30 Polyclonal antibody

CATALOG NUMBER: 31748-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C12orf30 (31748-1-AP) by Proteintech is a Polyclonal antibody targeting C12orf30 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 31748-1-AP targets C12orf30 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Calu-1 cells Positive IP detected in: mouse ovary tissue, HeLa cells Positive IHC detected in: human colon cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The C12orf30 gene encodes an auxiliary subunit of the N-terminal acetyltransferase B (NatB) complex, which is responsible for the acetylation of methionine residues at the N-terminus of proteins. The C12orf30 protein plays a role in the distribution and morphology of organelles, and is involved in cell migration and the dynamic changes of the cytoskeleton. In addition, polymorphisms in the C12orf30 gene are associated with susceptibility to various autoimmune diseases, such as rheumatoid arthritis, juvenile idiopathic arthritis, and type 1 diabetes. The C12orf30 protein also participates in regulating the function of immune cells, influencing their signal transduction. The theoretical size of C12orf30 protein is 113 kDa, and it is possible that post-translational modifications may have shifted the protein band up to about 140 kD. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36383 Product name: Recombinant human C12orf30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 703-972 aa of BC113585 Sequence: LNHPVEPKNSEKTAENGVSSRIDILRLLLQQLEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLENLVFFVETISVILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTLISNVVDHIKGLETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGELLKKRLETTKKLKI Predict reactive species Full Name: chromosome 12 open reading frame 30 Observed Molecular Weight: 113 kDa,140 kDa GenBank Accession Number: BC113585 Gene Symbol: C12orf30 Gene ID (NCBI): 80018 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q14CX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924