Iright
BRAND / VENDOR: Proteintech

Proteintech, 31756-1-AP, ADGB Polyclonal antibody

CATALOG NUMBER: 31756-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADGB (31756-1-AP) by Proteintech is a Polyclonal antibody targeting ADGB in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 31756-1-AP targets ADGB in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells Positive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information ADGB (Androglobin) is an evolutionarily conserved member of the globin protein family. It is specifically and highly expressed in spermatogenic cells (particularly sperm cells) of mammalian testes and in ciliated cells across various tissues. The ADGB protein possesses a unique structure, comprising a globin domain and a calmodulin-binding domain, suggesting its potential role in integrating gas (such as oxygen) sensing with calcium ion signaling functions. Current research indicates that ADGB plays a critical role in spermatogenesis within the male reproductive system, as well as in the formation and functional maintenance of cilia. Its functional deficiency may lead to abnormal sperm morphology and motility defects, thereby affecting male fertility. The target protein ADGB has a size of 235 kDa. This protein is unstable and prone to degradation, with degradation bands observed at 135 kDa, 70 kDa, and 55 kDa. (PMID: 36995441) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36246 Product name: Recombinant human C6orf103 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 550-700 aa of NM_024694 Sequence: ETATHSQTDLSQITKATSQGNTASQVILGKGTDEQTDFGLGDAHQSDGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVRWGEYGAL Predict reactive species Full Name: chromosome 6 open reading frame 103 Calculated Molecular Weight: 189kDa Observed Molecular Weight: 235 kDa GenBank Accession Number: NM_024694 Gene Symbol: C6orf103 Gene ID (NCBI): 79747 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N7X0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924