Iright
BRAND / VENDOR: Proteintech

Proteintech, 31768-1-AP, Tissue Factor/CD142 Polyclonal antibody

CATALOG NUMBER: 31768-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Tissue Factor/CD142 (31768-1-AP) by Proteintech is a Polyclonal antibody targeting Tissue Factor/CD142 in WB, ELISA applications with reactivity to mouse samples 31768-1-AP targets Tissue Factor/CD142 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108). This antibody is specific for mouse Tissue Factor. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1102 Product name: Recombinant Mouse Tissue Factor protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-251 aa of Sequence: AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE Predict reactive species Full Name: coagulation factor III Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 45-53 kDa Gene Symbol: Tissue Factor Gene ID (NCBI): 14066 RRID: AB_3670107 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P20352 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924