Iright
BRAND / VENDOR: Proteintech

Proteintech, 31781-1-AP, GPR112 Polyclonal antibody

CATALOG NUMBER: 31781-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPR112 (31781-1-AP) by Proteintech is a Polyclonal antibody targeting GPR112 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 31781-1-AP targets GPR112 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GPR112 is a member of the adhesion G protein-coupled receptor (aGPCR) family. These receptors are characterized by a complex architecture and large size, mainly attributed to their N terminus, which contains a variety of domains involved in cell-cell and cell-matrix interactions. The function of GPR112 and other aGPCRs is closely related to key aspects of the development, architecture, and function of the nervous system. They are involved in neuronal migration, axon guidance, dendritogenesis, and synaptogenesis. Additionally, aGPCRs, including GPR112, have been implicated in the development of myelinating glial cells, which are crucial for proper neuronal signal propagation. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36114 Product name: Recombinant human GPR112 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2400-2550 aa of NM_153834 Sequence: KWLLTNPTETAQTRCIKNEDGNATRFCSISINTGKSQWEKPKFKQCKLLQELPDKIVDLANITISDENAEDVAEHILNLINESPALGKEETKIIVSKISDISQCDEISMNLTHVMLQIINVVLEKQNNSASDLHEISNEILRIIERTGHKM Predict reactive species Full Name: G protein-coupled receptor 112 Calculated Molecular Weight: 333kDa GenBank Accession Number: NM_153834 Gene Symbol: GPR112 Gene ID (NCBI): 139378 RRID: AB_3670112 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IZF6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924