Iright
BRAND / VENDOR: Proteintech

Proteintech, 31797-1-AP, TTC9C Polyclonal antibody

CATALOG NUMBER: 31797-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TTC9C (31797-1-AP) by Proteintech is a Polyclonal antibody targeting TTC9C in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 31797-1-AP targets TTC9C in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: THP-1 cells, HeLa cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TTC9 family belongs to tetratricopeptide repeat (TPR)-containing proteins family (PMID: 35949301).The TPR motifs are arranged in antiparallel α-helical hairpins which are clustered to form flexible grooved interfaces. Members in TRP-containing proteins family are involved in a diverse range of biological functions, including cell cycle control, transcription, protein folding, and steroid receptor signaling (PMID: 15497498;PMID: 10786835). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37081 Product name: Recombinant human TTC9C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC032123 Sequence: MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFG Predict reactive species Full Name: tetratricopeptide repeat domain 9C Observed Molecular Weight: 22 kDa GenBank Accession Number: BC032123 Gene Symbol: TTC9C Gene ID (NCBI): 283237 RRID: AB_3670117 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N5M4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924