Iright
BRAND / VENDOR: Proteintech

Proteintech, 31806-1-AP, CD23 Polyclonal antibody

CATALOG NUMBER: 31806-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD23 (31806-1-AP) by Proteintech is a Polyclonal antibody targeting CD23 in WB, IHC, ELISA applications with reactivity to human, mouse samples 31806-1-AP targets CD23 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, RAW 264.7 cells Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CD23 (low affinity IgE receptor) is a transmembrane glycoprotein of the C-type lectin family that is expressed mainly on a variety of immune cells including B cells, macrophages, and eosinophils. It plays a key role in the regulation of IgE production and B-cell differentiation by binding to IgE and promoting IgE-dependent antigen uptake and presentation to T cells. In addition, CD23 is involved in allergen processing, immune cell activation and antigen-specific immune responses. In clinical applications, CD23 is a potential target for the treatment of allergic diseases, and its inhibition reduces IgE-mediated inflammatory responses. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1295 Product name: Recombinant Mouse CD23 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 51-331 aa of EDL21948.1 Sequence: TEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP Predict reactive species Full Name: Fc receptor, IgE, low affinity II, alpha polypeptide Calculated Molecular Weight: 38kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: EDL21948.1 Gene Symbol: Fcer2a Gene ID (NCBI): 14128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P20693-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924