Proteintech, 31835-1-AP, PLXNC1 Polyclonal antibody

Size: 20ul / 150ul The PLXNC1 (31835-1-AP) by Proteintech is a Polyclonal antibody targeting PLXNC1 in IP, ELISA applications with reactivity to human, mouse samples 31835-1-AP targets PLXNC1 in IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse brain tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Plexin C1 (PLXNC1) located on chromosome 12 is a member of Plexin family composed of transmembrane proteins. PLXNC1 which was first described in the optic tectum participates in neuron cell adhesion and migration as a target receptor of Semaphorin 7A. In addition to the role in nervous system, there is considerable evidence in favor of the involvement of PLXNC1 in human diseases through regulating immunological response. For example, knockdown of PLXNC1 plays the suppressive role in hepatic ischemia-reperfusion injury and lung injury through reducing inflammatory response. Nevertheless, the effects of PLXNC1 on the biological processes of OA remain to be elaborated (PMID: 37853395). PLXNC1 has multiple glycosylation sites, which may cause the observed bands to migrate differently.. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36558 Product name: Recombinant human PLXNC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1208-1348 aa of BC156867 Sequence: IPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKRHRGKHKFKVKE Predict reactive species Full Name: plexin C1 Calculated Molecular Weight: 1568 aa, 176 kDa Observed Molecular Weight: 150 kDa, 200 kDa GenBank Accession Number: BC156867 Gene Symbol: PLXNC1 Gene ID (NCBI): 10154 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O60486 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.