Proteintech, 31849-1-AP, ACTG2 Polyclonal antibody

Size: 20ul / 150ul The ACTG2 (31849-1-AP) by Proteintech is a Polyclonal antibody targeting ACTG2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31849-1-AP targets ACTG2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse skeletal muscle tissue, HepG2 cells, mouse stomach tissue, rat skeletal muscle tissue Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Actin gamma 2 (ACTG2, also known as ACT, ACTE, VSCM, ACTA3, ACTL3, and ACTSG) is a highly conserved protein involved in various types of cell motility and ubiquitously expressed in all eukaryotic cells. ACTG2 mutations would cause congenital distended bladder, microcolon, and intestinal hypoperistalsis (PMID: 24337657). It also has been reported that ACTG2 promotes hepatocellular carcinoma (HCC) migration and invasion through the Notch1 signaling pathway, which might serve as a new intervention target for the treatment of HCC (PMID: 28385530). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36024 Product name: Recombinant human ACTG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC094877 Sequence: MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPE Predict reactive species Full Name: actin, gamma 2, smooth muscle, enteric Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC094877 Gene Symbol: ACTG2 Gene ID (NCBI): 72 RRID: AB_3670128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P63267 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.