Product Description
Size: 20ul / 150ul
The RDH12 (31859-1-AP) by Proteintech is a Polyclonal antibody targeting RDH12 in WB, ELISA applications with reactivity to human samples
31859-1-AP targets RDH12 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293T cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag30460 Product name: Recombinant human RDH12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-316 aa of BC025724 Sequence: SLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGIRWE Predict reactive species
Full Name: retinol dehydrogenase 12 (all-trans/9-cis/11-cis)
Calculated Molecular Weight: 316 aa, 35 kDa
Observed Molecular Weight: 35 kDa
GenBank Accession Number: BC025724
Gene Symbol: RDH12
Gene ID (NCBI): 145226
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q96NR8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924