Proteintech, 31909-1-AP, CD20 Polyclonal antibody

Size: 20ul / 150ul The CD20 (31909-1-AP) by Proteintech is a Polyclonal antibody targeting CD20 in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples 31909-1-AP targets CD20 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat spleen tissue Positive IHC detected in: mouse spleen tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue, mouse colon tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CD20 is a 33-37 kDa transmembrane phosphoprotein. CD20 is a B-lymphocyte surface molecule that is widely expressed during B-cell ontogeny, from early pre-B-cell developmental stages until final differentiation into plasma cells. CD20 functions as a calcium-permeable cation channel. It is involved in the regulation of B-cell activation and proliferation. CD20 serves as a useful target for antibody-mediated therapeutic depletion of B-cells. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36918 Product name: Recombinant mouse Ms4a1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 204-291 aa of NM_007641 Sequence: GIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP* Predict reactive species Full Name: membrane-spanning 4-domains, subfamily A, member 1 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: NM_007641 Gene Symbol: Ms4a1 Gene ID (NCBI): 12482 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P19437 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.