Iright
BRAND / VENDOR: Proteintech

Proteintech, 31915-1-AP, SASH3 Polyclonal antibody

CATALOG NUMBER: 31915-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SASH3 (31915-1-AP) by Proteintech is a Polyclonal antibody targeting SASH3 in WB, ELISA applications with reactivity to human samples 31915-1-AP targets SASH3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Sterile alpha motif (SAM) and Src homology-3 (SH3) domain-containing 3 (SASH3), also called SH3-containing lymphocyte protein (SLY1), is a putative adaptor protein that is postulated to play an important role in the organization of signaling complexes and propagation of signal transduction cascades in lymphocytes. The SASH3 gene is located on the X-chromosome, which plays an important role in human lymphocyte function and survival (PMID: 33876203). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36154 Product name: Recombinant human SASH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-380 aa of BC051881 Sequence: DVLPEEAVGHARPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSLAGAP Predict reactive species Full Name: SAM and SH3 domain containing 3 Calculated Molecular Weight: 380 aa, 42 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC051881 Gene Symbol: SASH3 Gene ID (NCBI): 54440 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75995 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924